SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009491 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009491
Domain Number 1 Region: 17-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.79e-121
Family Aldose 1-epimerase (mutarotase) 0.0000000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009491   Gene: ENSOARG00000008843   Transcript: ENSOART00000009628
Sequence length 342
Comment pep:known_by_projection chromosome:Oar_v3.1:3:85357066:85409649:-1 gene:ENSOARG00000008843 transcript:ENSOART00000009628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVTRAVFGDLPLGAGTVEKFQLQSDQLRVDIISWGCTITALEVKDRQGRASDVVLGFD
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLAVNNGPNSLHGGVKGFDKVLWTP
RVLSNGVEFSRVSPDGEEGYPGELKVWVTYTLDGGELVVNYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDEVLIPTGEIASVQGTAFDLRKPVELGKHLQEFHVN
GFDHNFCLKGSKEKRFCARVHHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKSGAVYPK
HSGFCLETQSWPDAVNQPHFPPVLLKPGEEYDHTTWFKFSVA
Download sequence
Identical sequences W5PGC5
ENSOARP00000009491 XP_004006060.1.66739 XP_011988553.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]