SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009660 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009660
Domain Number 1 Region: 24-109
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.07e-19
Family Ribosomal L11/L12e N-terminal domain 0.00003
Further Details:      
 
Domain Number 2 Region: 100-172
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000877
Family Ribosomal protein L11, C-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009660   Gene: ENSOARG00000009001   Transcript: ENSOART00000009800
Sequence length 184
Comment pep:novel chromosome:Oar_v3.1:18:68505402:68505972:-1 gene:ENSOARG00000009001 transcript:ENSOART00000009800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAQRRQKVQLPLSSRIGVLPTPAASTMPPKFDPSEIKVRYLRCASGEVGATSALIPKIGP
LGRSPKKVGDNITRATGDCKSLRITVKLQNRQAWIEVLSSASALIIKVLKQPPRDRKKEK
NIKHSGNITFDETVDIAWQVQRRSLAGELTGTIKKILGSAPSVGCNADGRHPHDIIDDTN
CGGV
Download sequence
Identical sequences W5PGU4
ENSOARP00000009660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]