SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009927 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009927
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily Histone-fold 6.99e-33
Family Nucleosome core histones 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009927   Gene: ENSOARG00000009253   Transcript: ENSOART00000010070
Sequence length 106
Comment pep:novel chromosome:Oar_v3.1:20:29970904:29971224:1 gene:ENSOARG00000009253 transcript:ENSOART00000010070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFAMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRG
VLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Download sequence
Identical sequences W5PHL0
ENSOARP00000009927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]