SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010073 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010073
Domain Number 1 Region: 326-382
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000128
Family VPS37 C-terminal domain-like 0.0094
Further Details:      
 
Domain Number 2 Region: 63-132
Classification Level Classification E-value
Superfamily UBC-like 0.000000000144
Family UBC-related 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010073   Gene: ENSOARG00000009386   Transcript: ENSOART00000010219
Sequence length 398
Comment pep:known_by_projection chromosome:Oar_v3.1:26:18679972:18713343:-1 gene:ENSOARG00000009386 transcript:ENSOART00000010219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSSSAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVN
NLTININILLPPQFPQEKPVISVYPPIRHHLVDKQGVYVTSPLVSNFTMHSDLGKIIQSL
LDEFWKNPPVLAPASTAFPYLYSNPGGMPPYASQGFPFLPPYPPQEANRTMSSLSVADTV
SSSTTSYTTTKPAAPSFGVLSNLPLPVPTTDTSTPISQNGFGYKMPDIPDTFPELSELSV
SQLTDMNEQEDVLLEQFVTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLD
KYELLTQMKSAFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTDI
DDFLSSFMEKRTICHCRRAKEEKLQQVIAMHSQFHAPL
Download sequence
Identical sequences W5PI05
ENSOARP00000010073 XP_004021780.1.66739 XP_012014569.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]