SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010299 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010299
Domain Number 1 Region: 13-487
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-177
Family ALDH-like 0.00000000000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010299   Gene: ENSOARG00000009599   Transcript: ENSOART00000010452
Sequence length 493
Comment pep:known_by_projection chromosome:Oar_v3.1:18:4690980:4728935:-1 gene:ENSOARG00000009599 transcript:ENSOART00000010452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLPGPTCKTAGRQIFINNEWNESKSGKKFATYNPSTLEKICEVEEADKPDVDKAVEAAQ
AAFQRGSPWRRLDAPGRGRFGDNLATGILRPSFVLATLETMDTGKPFLHAFFIDLEGCIK
TLRYFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGN
TVVLKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGST
EVGKLVKEAASHSNLKRVTLELGGKNPCIVCADADLSLAVACAHQGVFFNQGQCCTAASR
VFVEEQVYEEFVRQSVEYAKKRPVGDPFDVRTEQGPQIDQKQFDKILDLIESGKKEGAKL
ECGGSAMEDRGLFIKPTVFSEVTDTMRIAKEEIFGPVQPILKFKNIEEVIKRANSLEYGL
TAAVFTKNLDKALKLASALESGTVWINCYNAIYAQAPFGGFKMSGNGRELGEYALAEYTE
VKTVTIKLDDKDP
Download sequence
Identical sequences W5PIN0
ENSOARP00000010299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]