SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010571 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010571
Domain Number 1 Region: 476-766
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.8e-76
Family Protein kinases, catalytic subunit 0.000000285
Further Details:      
 
Domain Number 2 Region: 320-403
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-34
Family Kringle modules 0.00036
Further Details:      
 
Domain Number 3 Region: 71-163
Classification Level Classification E-value
Superfamily Immunoglobulin 7.43e-22
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000010571
Domain Number - Region: 179-266
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00288
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010571   Gene: ENSOARG00000009860   Transcript: ENSOART00000010728
Sequence length 946
Comment pep:known_by_projection chromosome:Oar_v3.1:1:39058978:39250720:1 gene:ENSOARG00000009860 transcript:ENSOART00000010728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLGKQGLWKSPVMLLTAHKLLYLILPLSFSPPFSFFSETELSVTAELVPTSSWNISSE
LDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRISFRATN
YGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQ
PYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYA
FPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESP
EAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALR
FPELNGGHSYCRNPGNQKEAPWCFTLDENYKFDLCDIPACDSKDSKEKNKMEILYILVPS
VAIPLAIALLFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLS
AVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELH
HPNIVCLLGAVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGD
FLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSK
SLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLL
PCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTT
SLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFISPPIPQNQRFIPINGYPIPPGYAAF
PAAHYQPTGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIP
NHPSGMGITVFGNKSQKPYKIDSKQPSLLGDSNIHGHTESMISAEL
Download sequence
Identical sequences W5PJF0
XP_012021952.1.66739 ENSOARP00000010571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]