SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010608 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010608
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.13e-47
Family Regulator of G-protein signaling, RGS 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010608   Gene: ENSOARG00000009891   Transcript: ENSOART00000010765
Sequence length 153
Comment pep:known_by_projection chromosome:Oar_v3.1:12:11007750:11028987:-1 gene:ENSOARG00000009891 transcript:ENSOART00000010765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVKGRCCFHRSPTTETMAWSENMDTLLTNQAGLDAFRTFLKSEFSEENVEFWLACEDFKK
TESAEKIASKARMIYSEFIEANAPKEINIDFSTRDLISKNIAEPTLKCFDEAQKLIYSLM
AKDSFPRFLKSEIYKKLVNSKEIGNHKKWLPFL
Download sequence
Identical sequences W5PJI7
ENSOARP00000010608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]