SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010751 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010751
Domain Number 1 Region: 28-227
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000408
Family Quinoprotein alcohol dehydrogenase-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010751   Gene: ENSOARG00000010013   Transcript: ENSOART00000010909
Sequence length 1007
Comment pep:known_by_projection chromosome:Oar_v3.1:2:246238637:246262242:1 gene:ENSOARG00000010013 transcript:ENSOART00000010909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASRLWLWAALLIPAAAVYEDQVGKFDWRQQYVGKLKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEILWRHVDKGTAEGVVDAMLLCGQDAITVSNGGRIMRSWETNIGGLNWE
VTLDSGSFQALGLVGLQEAVRHIAVLKKTTLALHHLSSGHPKWVEHLPESDSIHYQMVYS
YGSGAVWALGVVPFSHVNVVKFNVDDGEIIQQVRVSTPWLRSLAGACGVVDEAVLVCPDP
SSQSLQTLALETEWELRQTPLQSLDLEFASGFQPRVLPTQPSPVDPSRAQFFLQLSPSHY
ALLHYRHGVLSLLKNFPQAALVSFATTGEKTVAAVMTCRNEAKPSVSEDGSPGSFSEKSG
SQDSLACFNQTYTINLYLVETGRRLLDTAITFSLEQNGTRPERLYIQVFLKKDDSVGYRA
LVQTEDHLLLFLQQLAHHFSFWPKMGVAPLAEVVCGEVGALPLTGAQAELEGEFGKKADG
LLGMFLKRLSSQLILLQAWTSHLWKVFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMV
TASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLLKDKETGMS
SLYVFNPIFGKWSQVAPPVLKRPVLQSLLLPIMDQDYAKVLLLIDDEYKETVKSLEKSML
RDSFSFNPSIFFYLVDADQGRLCGYRLRKDLTTELSWELTIPPKEQPLRQRATGAWASWT
PGGRGARIGLWRSLNPNLLAVVTESTDAHHERAFIGIFLVDGVTGRIIHSSVQRKAKGPV
HIVHAENWVAYQYWNTKARRNEFTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPS
AISAMEATITERGITSRHLLVGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDV
QIHAERFINYNQTVSRMRGIYTAPSGLESTCLLRRGLRYGLDIYQTRVYPSKQFDVLKDD
YDYVLISSVLFGLVFTTMITKRLAQVYLESLLLASKVRGNTCDNSTL
Download sequence
Identical sequences W5PJY0
ENSOARP00000010751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]