SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010910 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010910
Domain Number 1 Region: 112-205
Classification Level Classification E-value
Superfamily Acid proteases 2.64e-26
Family Retroviral protease (retropepsin) 0.0012
Further Details:      
 
Domain Number 2 Region: 10-97
Classification Level Classification E-value
Superfamily dUTPase-like 1.57e-17
Family dUTPase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010910   Gene: ENSOARG00000010173   Transcript: ENSOART00000011068
Sequence length 205
Comment pep:novel chromosome:Oar_v3.1:18:10434935:10435564:-1 gene:ENSOARG00000010173 transcript:ENSOART00000011068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLYPQAVPSRIPTRLFGSLPPQTFGLLLGQSSLTSKGITVHPGVIDSDYKREIQTMMLSQ
ILWQFKKGDKTAQLHFLPYISINSSNELRMGGFGSTDQKQSFWTTLVSEFAQPTINIKIN
GKRFSGLLDTGSDITIISKHSWPKSWPVQIAGISQTKVQEVYQSTQIYPCEEPEGQPATL
RPSVIDAPLNLIGREILMQWQTQIY
Download sequence
Identical sequences W5PKD9
ENSOARP00000010910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]