SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010963 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010963
Domain Number 1 Region: 139-273
Classification Level Classification E-value
Superfamily Acid proteases 2.5e-26
Family Retroviral protease (retropepsin) 0.00043
Further Details:      
 
Domain Number 2 Region: 15-141
Classification Level Classification E-value
Superfamily dUTPase-like 1.19e-25
Family dUTPase-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010963   Gene: ENSOARG00000010226   Transcript: ENSOART00000011121
Sequence length 289
Comment pep:novel chromosome:Oar_v3.1:X:133517367:133518233:-1 gene:ENSOARG00000010226 transcript:ENSOART00000011121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASDNNRGSCIAELLRATPGSVGLDLSSTTAAILTPGMPVTPIPMKVVGPLPEGIVGLVL
GCSSLSFQGISVVPDVVDSDYTGEIKVLISLPTKTVQINKGQRIAQLLLLPHYQTGKTLT
SQARGPRGFGSSDLDFWVQEITASRTLKDLLIQRNKISGLLDIGADVSCIAGKDWPSSWP
TRLTSAGLVGAGSVPSVAKNSQILAWSDEKGAQGTFCPYVVPSLPFSLSGRDILSQMGML
LYSPDEKVTNQMLQMRYNPDKALGKDQQAIVSPLKVVPNKNRESLGYSN
Download sequence
Identical sequences W5PKJ1
ENSOARP00000010963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]