SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011132 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011132
Domain Number 1 Region: 291-393
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.24e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011132   Gene: ENSOARG00000010374   Transcript: ENSOART00000011292
Sequence length 1159
Comment pep:known_by_projection chromosome:Oar_v3.1:12:43655052:43723214:-1 gene:ENSOARG00000010374 transcript:ENSOART00000011292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPCEDVERSSGKSENPRGNQRHELEGQQASGPEAPENDAAELWSQKCELRSKFVQTSNS
EQQNRNRVSDELITVVQEMKKYFPSERHGKPNTLDALNYALLCVHSVQANNESFQILSQN
GAPQGDVTLCSLEELATIASGHTSKTTGTFVAVFSFLSGRLVHISEQAPSILNCQKEFLE
SCHFVELLAPQDMRVFYTHTAHAQLLFWNNWTQREASQYELAPVKSFFCRIGGGEAGELQ
RPYCPFRITPNLIHVHSSALMEPEPCCLLLAEKIHSGYQAPQIPADKRIFTTTHTPGCVF
LEIDERAVPFLGYLPQDLIGTSILAYLHPEDRPLMLAMHQKVLKYAGHPPFEHLPIRFCC
QNGDYVILDSSWSSFMNPWSRKVSFIIGRHKVRTSPLNKDVFATRVKKVSNDDKDTTELQ
EQIQKLLLQPVHGSKSSGYGSLGSSGSQEPQVSLASSSESSGHGVDEVPEAPLTLQQICA
SVNKIKNLGQQLYVESRAKSANKPVSGTRSGRPGDEQKTSSSFQTVKNNSMYTESCEDLR
KVQRSPSYQQINCIDSVTRYLKSYHIPVLKRKCISSTNTTSSSSEEDRQSHRADDIQALQ
AISQIPTVPASEMPTKGQSTDAEGGAPWTLSTVTLSLDTSQCSSSSVLVDIPPPDSELTP
AEHVPLACEPWTLSTHPAPLAAEAFKHSGLAKAVLSAHAQKEEQSYVDKFQEKILSSPCS
FYLQQESRSKAKYLYVQGGSASRLARSAGCRKGKHKRKKPLMWSDGRSAKDHFCPHQDGQ
PWCPSSASCPHASGPSLPATVMVPSPAPCLVPALRLPATTSLGREHEALITVLPRLPEPP
LPSSLQYFPALPSAYFNTFVNLFLHDPSLSPLSSLSFSPYPFLGAAPSSEILSSVSAVAP
NPGPLSSTINPRSREEKWETRNEGHPLINSGSSSMLQLDLLQGDRPRSCASPETVCGVRG
SSGTEIDGFTIKKPSIASLHSVSPPGTGPAASGSSGSSINFAPSDDSSEISENGQQSQDI
QKKGTFPKLAEESIWRMIKQTPDRILMTYQVPERVKEIVLKEDLEKLESMRRQQPQFSRG
QREEIANVHSWIHSRAIPREIDTQGCVTCGHRDSAGDAADPTVRIQQKQQPSDSEGPALP
LQTCWTAPPPCDSLRTLAA
Download sequence
Identical sequences W5PL09
XP_012042759.1.66739 ENSOARP00000011132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]