SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011189 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011189
Domain Number 1 Region: 42-321
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-109
Family Inorganic pyrophosphatase 0.0000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011189   Gene: ENSOARG00000010430   Transcript: ENSOART00000011349
Sequence length 339
Comment pep:known_by_projection chromosome:Oar_v3.1:6:19864955:19945670:1 gene:ENSOARG00000010430 transcript:ENSOART00000011349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XALLPLLRTSWAWPVGAAAAAAARLPRGASAGPGPRRTMALYRTEERGQPHSPDYRLFFK
NVAGHYISPFHDIPLKVDSEEENGIPTKRARNDEYENVFNMVVEVPRWTNAKMEIATKEP
LNPIKQDVKDGKLRYVANIFPHKGYIWNYGALPQTWEDPHRKDKSTDCCGDNDPIDVCEI
GSKVLSRGEVVHVKILGVLALIDQGETDWKLIAINVNDPEASKFHDIEDVKKYKPGYLEA
TLNWFRFYKIPEGKPENQFAFNGEFKNKAFALEVIKSTHECWKALLMDKCDGGAINCTNV
QVCDSPFHCSEEEARSLVESLVWLPHKRSFSKENIFRFL
Download sequence
Identical sequences W5PL66
ENSOARP00000011189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]