SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011203 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000011203
Domain Number - Region: 259-308
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00654
Family RILP dimerisation region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011203   Gene: ENSOARG00000010443   Transcript: ENSOART00000011363
Sequence length 514
Comment pep:known_by_projection chromosome:Oar_v3.1:14:52576902:52588825:1 gene:ENSOARG00000010443 transcript:ENSOART00000011363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPAGLQVDYVFRGVEHAVRVMVSGQVLELEVEDRMTADQWRGEFDANFIEDLTHKTGN
FKQFSIFCNMLESALTQSSESVTLDLLTYTDLESLRNRKMGGRPGPLASRSAQLNSKRYL
ILIYSVEFDRNYWYPRPLPYQGKPDPVVLQGIIRSLKEELSRLRGLDGQDTRDGRETEIW
HLREHVGKLAASWEREVGGEEGRGEQVTLGLVGVDAESWIPVLKGRVNPASLGCRAWCLR
SASWRPSWAAPLPSVHLEEVKASERSLRARLKALNTELALYKRGRRTPPVVPPSVREDRA
STSRERSTSRGRGATRSSSRESGRGGRGRGRPARPSPSPTGGRVPRFDPTAFVKAKEKKQ
REIKMKLEHVSSQQQRNRLGSGGSGDGPSVSWSRQTRPPAREAHTLRLPLVDSFRSRYSS
ASSCSELEDFSESLPRGVRRRRGKPPSPTTWSGFNTQQKSTPLERGRHQRRLASSGGWVP
IKEYSSDHQAADMAEIDARLKALQEYMNRLDTGS
Download sequence
Identical sequences W5PL80
ENSOARP00000011203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]