SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011237 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011237
Domain Number 1 Region: 156-217
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000765
Family BCR-homology GTPase activation domain (BH-domain) 0.0027
Further Details:      
 
Domain Number 2 Region: 15-86
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000148
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011237   Gene: ENSOARG00000010472   Transcript: ENSOART00000011397
Sequence length 223
Comment pep:known_by_projection chromosome:Oar_v3.1:11:44468544:44476946:-1 gene:ENSOARG00000010472 transcript:ENSOART00000011397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQSLSPSNQRRQPSKLSIPEFTVDLKGASLTWAPKDKSSKKNVLELRSRDGSEYLIQHD
SEAIISTWHSAIVQGIQEMSADLPPEEESENSVNFGSSERLGSWREDEPRPGAAPPTPGP
GGLEGDISKVRQKLLKFLLRRPTLQSLREKGYIKDQVFGCPLAELCEREKSSVPRFVQQS
IRAVEARGLDIDGLYRISGNLATIQKLRYKVDHGESAWGRWGG
Download sequence
Identical sequences W5PLB4
ENSOARP00000011237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]