SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011426 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011426
Domain Number 1 Region: 31-515
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-183
Family ALDH-like 0.0000000000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011426   Gene: ENSOARG00000010650   Transcript: ENSOART00000011586
Sequence length 520
Comment pep:novel chromosome:Oar_v3.1:17:61935603:61959962:-1 gene:ENSOARG00000010650 transcript:ENSOART00000011586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVFYNQIFINNEWHDAVSKKTFPTV
NPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRT
YLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNI
IPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKTRVVGNPFDSRTE
QGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS
Download sequence
Identical sequences W5PLV2
ENSOARP00000011426 XP_004017458.1.66739 XP_011967740.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]