SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011458 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011458
Domain Number 1 Region: 14-42,69-457
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.89e-111
Family alpha-mannosidase, C-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011458   Gene: ENSOARG00000010677   Transcript: ENSOART00000011618
Sequence length 478
Comment pep:novel chromosome:Oar_v3.1:6:112366855:112379157:1 gene:ENSOARG00000010677 transcript:ENSOART00000011618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAITGTHAVKVGDMFVEHLSTGMEGVHKLMASIIQDRSPANSGAPGVRGGLGGSSRACSL
CACPEPGGHFAVVYNPLAWTVTTIITLTVGFPNVSITDDSGHPVPAQVQSSKEMPSAYDL
HVLTTIPGLSYQHYSIRPSRSSQEATGETAPFVASTQHFGHRLRRHGGQVGCHLVPVEND
CYTMFLDTDTNLMHSIWERGSNRTVRVTQSFMEYHVKSDVDHGSVSDNYVFTPSGAAEPA
WEAVRMEIVEGPLVTEIRQYFYRKVNDSEPTFAIYSRLARSPQGSDGELLCHRIEQEYRA
GPLELNREAILRTSTDLNTGRVLHSDNNGYQMQRRPYRQNMWNTIARNYYPMVQSAFIED
LPSRLVLLSEQAHGVSSQGNGQVEVMLHRRLWNNDKWALDNDLTLNDSSVVHPVLWLLLG
PRALTSGLRQRSGLALQHRPVVMLREMNGEYCPPADPQHPRLEIQLEPHRAPADSPER
Download sequence
Identical sequences W5PLY4
ENSOARP00000011458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]