SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011788 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011788
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 5.49e-46
Family Eukaryotic RPB5 N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 135-209
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 2.49e-30
Family RPB5 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011788   Gene: ENSOARG00000010994   Transcript: ENSOART00000011960
Sequence length 210
Comment pep:known_by_projection chromosome:Oar_v3.1:5:40977416:40981507:-1 gene:ENSOARG00000010994 transcript:ENSOART00000011960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Download sequence
Identical sequences A0A0A0MX41 A0A0D9RIT2 A0A1S3FQQ8 A0A212D2P2 A0A250YC76 A0A2J8R9W1 A0A2K5FAF8 A0A2K5HTZ0 A0A2K5KMT8 A0A2K5QIJ3 A0A2K6CA13 A0A2K6EY38 A0A2K6KEJ9 A0A2K6RJA1 A0A2K6TP67 F2Z4J4 F7BX20 G1L8X2 G1PM86 G3R6M6 G7PYA0 H0UWG3 H0X6L6 I2CYA3 I3LSI7 I3M186 K7CNC1 L8IUG8 U3BJZ4 W5PMW3
ENSPANP00000011318 ENSECAP00000008965 6exv_E 6gmh_E 6gml_E 10141.ENSCPOP00000001395 9796.ENSECAP00000008965 9913.ENSBTAP00000027684 ENSAMEP00000003341 ENSBTAP00000027684 ENSCPOP00000001395 ENSECAP00000008965 ENSSTOP00000002554 ENSOARP00000011788 ENSGGOP00000010988 ENSSTOP00000002554 ENSOGAP00000011011 gi|14589951|ref|NP_002686.2| ENSCPOP00000001395 ENSAMEP00000003341 ENSSSCP00000027080 ENSSSCP00000027080 ENSGGOP00000010988 ENSOGAP00000011011 ENSBTAP00000027684 ENSMLUP00000012002 ENSMLUP00000012002 NP_002686.2.87134 NP_002686.2.92137 XP_001496313.1.31192 XP_003354010.1.46622 XP_003461007.1.53824 XP_003788737.1.62490 XP_003944520.1.74449 XP_004008821.1.66739 XP_004059685.1.27298 XP_004378575.1.4749 XP_004441421.1.5094 XP_004632723.1.9945 XP_005332013.1.77405 XP_005682957.2.57651 XP_005866739.1.60319 XP_005890517.1.15283 XP_006050556.1.26621 XP_006101858.1.53796 XP_006740834.1.47382 XP_006740835.1.47382 XP_006764858.1.95426 XP_006876774.1.41390 XP_006898004.1.29581 XP_007130196.1.24612 XP_007176695.1.59432 XP_007460458.1.90284 XP_007952743.1.48129 XP_007992763.1.81039 XP_007992764.1.81039 XP_008148920.1.99482 XP_009432536.1.37143 XP_010330737.1.74449 XP_010373218.1.97406 XP_010373219.1.97406 XP_010373220.1.97406 XP_010633258.1.5607 XP_010842884.1.44457 XP_011747452.1.29376 XP_011747458.1.29376 XP_011819383.1.43180 XP_011819384.1.43180 XP_011819385.1.43180 XP_011928221.1.92194 XP_011928222.1.92194 XP_011928223.1.92194 XP_011928224.1.92194 XP_011971573.1.54773 XP_012291616.1.9421 XP_012500853.1.63892 XP_012500854.1.63892 XP_012601180.1.48125 XP_012601181.1.48125 XP_012601183.1.48125 XP_012659927.1.62490 XP_012659928.1.62490 XP_012878359.1.60039 XP_014596768.1.31192 XP_014651478.1.5094 XP_014977818.1.72884 XP_014977819.1.72884 XP_015295622.1.63531 XP_015295623.1.63531 XP_016065187.1.3490 XP_017369952.1.71028 XP_017369953.1.71028 XP_017741144.1.44346 XP_017741145.1.44346 XP_019512808.1.44202 XP_019599628.1.88060 XP_019599629.1.88060 XP_019659646.1.58354 XP_019659647.1.58354 XP_019820407.1.53367 XP_020030711.1.5219 XP_020745990.1.74333 XP_021560762.1.83697 XP_021560763.1.83697 XP_021560764.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]