SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011988 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011988
Domain Number 1 Region: 2479-2666
Classification Level Classification E-value
Superfamily BRCA2 helical domain 9.16e-85
Family BRCA2 helical domain 0.0000000423
Further Details:      
 
Domain Number 2 Region: 2829-2965
Classification Level Classification E-value
Superfamily BRCA2 tower domain 3.01e-58
Family BRCA2 tower domain 0.00000175
Further Details:      
 
Domain Number 3 Region: 3050-3182
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-52
Family Single strand DNA-binding domain, SSB 0.00000667
Further Details:      
 
Domain Number 4 Region: 2667-2798
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.68e-45
Family Single strand DNA-binding domain, SSB 0.0000012
Further Details:      
 
Domain Number 5 Region: 2800-2829,2966-3049
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.8e-36
Family Single strand DNA-binding domain, SSB 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011988   Gene: ENSOARG00000011179   Transcript: ENSOART00000012162
Sequence length 3427
Comment pep:known_by_projection chromosome:Oar_v3.1:10:28872321:28924433:-1 gene:ENSOARG00000011179 transcript:ENSOART00000012162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIGCKERPTFFDIFKTRCNKADLGPISLNWFEELSSEAPPCNSELSEELEYKISSYETN
PFKTPQRKPYHQLASTPVIFKEQSLTLPLYQSPLKELHKFRSDSGKDIANSKHKSCCRVK
AKINQANDVISPPPNSSLSESPVVLRCTYVTPQREKSVVCGSLFHTPKLIKGQTPKRISE
SLGAEVDPDMSWSSSLATPPTLSSTVLIVQDEEASAAVFPSDTTTILKTYFSNHDESLKN
SKFIPSGPDSDNKNQTEAESHGLEKILEDSFGKVSSCKDHFEKSLPNVLEDEVHETVAGI
SEEDSLPVCVSKYKTKKLQKTKTGKTRKNIFHETKTDDCEGAKKEMTESKHSFVCETEPN
DSDPLDSNVINQKPAGNGTDIISREVVPSSVSEWSQLTLSSLNGTQVEKTSLLHISCDQT
NSEEDFIGTEKDCTNFITLENSLPHISSISKIVKILNKETVVNKTDEGRCLESHEDPTTM
GQQTLTDSSPLQGIKKSTFRIRESPEKILREDFSNNVTDTNLKEEPEDSKSESEIQTIYS
QKEDFVCSSSGDNESWPATTKHTSEALKSTGLISTLKKKTKKFIYVINDKTTYQELKIQK
DQESELTNSSAQFEAKPLEAPHTFTNVDSGSLHSSVQKNCSQNDSEEPSLSLTSSFGTVL
RKCFNNESSSSNNQKISQDLYCKETNINKEKWQSFITTETDYVSCLQDKHCEDNPKSQGV
SDIKEKVLPVVCRPELPHSEECSDTVFQFQESFLHDHENTTILTPSSKDLLSNPVVISRG
KQSYKMSEKIKSKNCEAGFELTKYISMEKNQETCVLNENSKKPEMLSPEKYITGASPSVK
VQCYQNMNLTVIHKDQEETTLISKRTVNPNSEELFPDNENNYIFQTTSERNIPILGNIKE
IHEADLSCLKEPVLKNSVIVTSTDMDGGQAAKVSITKDSVSSNIVHDLIEKNRNSIKQQP
KMTLGQDSKPDVSLDTDTRSNRNNFCGDKWAGLSDLTSGHSFGNGFRTASNKEIKLSEHN
IKKSKTLFKDIEEHYPASLAWVESVKSLENQKKEGQPHDHDSQSIDTVCGYVQNGAVVSD
GENSHTTPPVLSLKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSHRLQSN
PFEMPETQMPVSNTTSEEQKDVDLHLTASVPSLSHVDNSKKCGLVGHEQKLICLSTTKCN
KSVSGSLTDKSEEEFKGFYSARGTKLNFSNEALQKAMKLFSDIEKVSEETPAEVDPGSFS
SDQCNDSDVSMFKVENYSNDKNLSEENNKCQLILQSNFEMTTSIFVKENTEDFKRNTENK
DNKCTDFVCNLGESDGCASSKNDTVYVHKDESGLPYTDQYNIHLKLSHHFMKEENIPIKE
GLSDLTCLEVMKAEETFNKSDKKEPIANKMRQNIKDFGVFDLSFWTASRKNIRVSKESLN
KVVNFFDEKCTEKEFNHFSDSSNSELLSGIHINKKDISSHEETSMFKNKMLKESSPAGIE
NQILTLQQREKCELKKIREPTMLGFHTASGKKVKIAKESLDKVKNLFDETKQDNSEVTGF
IHQEAKMLKNKEVCKEGLDLACEIVKVTAPQHEEMQNSLEEKKLVSEETAMPPRFLSDHL
HRQTENLHTSHSISLKVKVHENMEEETAKSPLSCYTNHSTFSAIDNSALAFYTGHGRKIS
VSQASLLEAQKWLREGELNDQPEKTNSSEIICLKEYTGDYVQNPSCGNSSNSIITENDKS
LSQKQDSTSLNNNMPNSYSYHSDFCHSSEGFNKSEYLSKNKIDNSGIEPVVKNVKDRKNT
SFSEVIPTIRETNINPQALDKDSCVLKLMTKFSPCKNKKTAVEVALSNSNNFETEPPAYS
TASDQIAFVSGETTVRERFTDNCRNIYIKQNTETKSGTDQTKTVTESHKALGDSEDVIFP
NSPDNEEHNMHSQDVSHDIQGEPILQHDQSTSGLEKVSEIPLRHVDLKTSDRCKFNMGNH
PRSVSSMNACGIFNTASGKSVQVSDSALRKARQVFSKSEDSAKQLFSTVSFESNEHSDIF
RRKDNIMAHNPPNLLSSAFSGFSTASGKHVPVSESALRKVKGMFEEFNLIETEYSLQHSP
TSTQDISKILPVSCTDKRTPEHSLSSKMEKAYNKEFKLSNNYNTESGSSENNHSIKVSSY
LSEFKQDQQQSVLGTRVSHIDNIHLTGKKQTLPKNIKKEIGKTETFPDLVKTNTEICSTD
SKDPENYFETEAVEIAKAFMEDGELTDSEFPSHAKHSPLTCHKNEETVLSNSRIEKRKGD
ALITVGEPPIKRNLLNEFDRIIENQGKSLKASKSTPDGTMKDRRLFMHHFSLEPVTCGPS
CVTTERQEIQNPNFTAPGQEFLSKSQFYEYLTLGKSSSNLSISGQPLCKVPDPRNEKRRH
SITVGKPMKVFVPPFKTKSHIHRDEQFVGKNTNLENKQKQKNVDEHGSGDSENNVNNCET
HQTTTIHFTKGEEEPLGSITNLQNARDIQDMRIRKKQRQRIFPQPGSLYLAKTSTMPRIS
LREAVEGRIPSVCSHKRLYMYGVSKHCVKINSKNAEAFQFHTQDYFGKEGLWTGKGIQLA
DGGWLIPSNDGKAGKEEFYRALCDTPGVDPRLISRVWVYNHYRWIIWKLAAMEFAFPKEF
ANRCLNPERVLLQLKYRYDVEIDRSKRSAIKKIMERDDTAAKTLVLCVSEIISLSTDISE
PSSNKTSSVDATKVAIIQLTDGWYAIKAQVDPPLSALLKNGRLTVGQKIVIHGAELVGSP
DACTPLEAPESLMLKISANSTRPACWYAKLGFSPDPRPLPLPLSSLFSDGGNVGCVDIII
QRAYPIQWMEKTSTGLYIFRNEREEEKEATKYAEVQQKKLEALFTKIQAEFEDHEENVTE
QCIPSRALTRQQVRALQDGAELYEAVKNAPDPSYFEGYFSEEQLRALNNHRQMLNDKKQA
QIQVELRKAMESAEQGEQILPRDVTPVWKLRIMSYKRKEKDSVILNIWRPSSELYSLLTE
GKRYRIYHLTASKSKSKYERANIQLTATKKTQYQQLPASDEILLQIYQPREPLHFSKLLD
SDFQPPCSEVDLIGFVVSVVKKIGIAPLVYLSDECHNLLAIKFWIDLNEDIIKPHILIAA
SNLQWRPECKLGIPTLFAGDFSMFSASPKEGHFQEAFHKMKNTVENIDMFCEDAKNKLIR
LLNASNPKWSTPTKDCTSAPPTAQTVLGSGNKFPLSSPSSEMNYQSPLSLCKLKEKSVCT
PVSAQVTSKSCCKGEKETDDRKSCKKRRALDFLSRLPVPPPVSPICTFVSPAAQKAFQPP
RSCGTKYETPMKKKELTYPQMTPLENLNNISLLESDSIADEELALINTQALLSGSAGGNQ
LTSTSKSNRTVPTSPKDYVGLKRPYTTSVIKERENSPARTEEQETNMQDTSAIKNISKRL
QRRLKPK
Download sequence
Identical sequences W5PNG2
ENSOARP00000011988 XP_004012185.1.66739 XP_012039990.1.66739 XP_012039992.1.66739 XP_012039993.1.66739 XP_014953441.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]