SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012126 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012126
Domain Number 1 Region: 24-112
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.35e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 101-174
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.83e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012126   Gene: ENSOARG00000011320   Transcript: ENSOART00000012302
Sequence length 191
Comment pep:known_by_projection chromosome:Oar_v3.1:14:46881856:46882431:1 gene:ENSOARG00000011320 transcript:ENSOART00000012302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARRRQRCNFLRSSRIRVHPTPAASTMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGP
LGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKK
QKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDD
INSGAVECPAS
Download sequence
Identical sequences W5PNV0
ENSOARP00000012126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]