SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012171 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012171
Domain Number 1 Region: 66-176
Classification Level Classification E-value
Superfamily FKBP-like 5.5e-40
Family FKBP immunophilin/proline isomerase 0.00000128
Further Details:      
 
Domain Number 2 Region: 287-444
Classification Level Classification E-value
Superfamily TPR-like 1.42e-33
Family Tetratricopeptide repeat (TPR) 0.000000136
Further Details:      
 
Domain Number 3 Region: 171-286
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-28
Family FKBP immunophilin/proline isomerase 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012171   Gene: ENSOARG00000011357   Transcript: ENSOART00000012347
Sequence length 488
Comment pep:known_by_projection chromosome:Oar_v3.1:3:210939318:210945747:-1 gene:ENSOARG00000011357 transcript:ENSOART00000012347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQEREVSLILAKPHSSHLMMGLLSYLQGGRGDHLHSGQRHANIHGSSLCPSPGTHLLSF
PSFQVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDRFSFDLGKGEVIKAWD
IAVATMRVGEVCHITCKPEYAYGLAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGII
RRTRTRGEGYAKPNEGAIVEVALEGYFKDQMFDQRELRFEIGEGESMDLPCGLEKAIQRM
EKGEHSIVYLKPSYAFGSTGKEKFQIPPNAELKYEIHLKSFEKAKESWEMSSEEKLEQST
IVKERGTVYFKEGKYKQAVLQYKKIVSWLEYESSFSDEDAEKAQALRLASHLNLAMCHLK
LQAFSAAIENCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKA
QLVVCQQRIRKQLEKEKKLYANMFERLAEEENKAKAAVAAGDQPADAEMRDEPKNDVAGV
KPQVEAEA
Download sequence
Identical sequences W5PNZ5
ENSOARP00000012171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]