SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012253 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012253
Domain Number 1 Region: 189-314
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000846
Family Glyoxalase I (lactoylglutathione lyase) 0.012
Further Details:      
 
Domain Number 2 Region: 337-445
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.000000000183
Family Glyoxalase I (lactoylglutathione lyase) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012253   Gene: ENSOARG00000011431   Transcript: ENSOART00000012429
Sequence length 482
Comment pep:known_by_projection chromosome:Oar_v3.1:11:21675018:21701382:1 gene:ENSOARG00000011431 transcript:ENSOART00000012429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRLTPFSFSMGSSFMYSRRLKKKTLGTAPALRASAISLRPSSRIFPCFSRNGLDLTMVIT
LLWVETKRESLIIAKPRLFPGAGGLGCWPLNLLLLSLLPGTGLCRRLGCFLGSSLRSTTS
SDGNSTFTGLRRNARTQRRASRSEACTTGSNGRVAHPTPPSGLRHESAPAVASDITNAPA
SAVVVMANRRALHFVFKVGNRFETACFYRDVLGMKILRHEEFEDGCKAACNGPYDGKWSK
TMVGYGPEGDHFVTELTYNYGIGSYQLGNDFLGITVASRQAVSNARKLKWPLSEMGDGVF
ETKAPGGYKFYLQDCSPPQSGNVLIMFYLNSDFVRLNYWSNLLGMKIYEKDEKEQRALLG
YADNQCKLELQAIPGKVDHATGFGRIAFSCPQKELSDIEDLMKRENQKILTPLVSLDTPG
KATVQVIILADPDGHEICFVGDEAFRELSKVDPEGNKLLDDAIAGDKSDEWFAAQKKPKA
TG
Download sequence
Identical sequences W5PP77
ENSOARP00000012253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]