SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012303 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012303
Domain Number 1 Region: 36-93
Classification Level Classification E-value
Superfamily Kringle-like 1.77e-18
Family Fibronectin type II module 0.0035
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000542
Family Fibronectin type II module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012303   Gene: ENSOARG00000011476   Transcript: ENSOART00000012479
Sequence length 96
Comment pep:novel chromosome:Oar_v3.1:14:53854491:53855240:-1 gene:ENSOARG00000011476 transcript:ENSOART00000012479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHNYSCIFPFMYDDIIYYNCISVRSDYAWCSIDKIFQGRWRYCTAEDPPSCTFPFLFRNK
YFYKCTKEGYVLSRSWCSLTRDYNKDGKWKQCSPHQ
Download sequence
Identical sequences W5PPC7
ENSOARP00000012303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]