SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012331 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012331
Domain Number 1 Region: 381-496,615-755
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.45e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Domain Number 2 Region: 5-361
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.07e-68
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012331
Domain Number - Region: 467-610
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.002
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012331   Gene: ENSOARG00000011501   Transcript: ENSOART00000012510
Sequence length 859
Comment pep:known_by_projection chromosome:Oar_v3.1:8:34947839:35493542:-1 gene:ENSOARG00000011501 transcript:ENSOART00000012510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGP
SHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKW
KTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFD
CSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQV
SSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVGVQQFPQMTVSSLQCNR
HKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPAS
GLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRE
LSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDF
SKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEW
YNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIIS
SYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFM
SSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTP
MGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAA
GLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEE
VINMHTFNDRRLPGKETMA
Download sequence
Identical sequences F1P7K5 F1RYR0 L5JKX4 W5PPF5
ENSCAFP00000005339 ENSOARP00000012331 XP_012038110.1.66739 XP_020929035.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]