SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012335 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012335
Domain Number 1 Region: 36-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.18e-68
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 412-527,637-774
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.87e-65
Family Phosphate binding protein-like 0.00000000109
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012335
Domain Number - Region: 498-642
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00388
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012335   Gene: ENSOARG00000011501   Transcript: ENSOART00000012514
Sequence length 878
Comment pep:known_by_projection chromosome:Oar_v3.1:8:34947839:35404386:-1 gene:ENSOARG00000011501 transcript:ENSOART00000012514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTHRKCYFVLFLTSKMLQFASGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTY
DTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQV
SDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLR
LKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTT
LDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTT
DAALMYDAVHVVSVGVQQFPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFN
KTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTI
LEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQW
NGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNP
LSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGA
LMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTDLAKQTKIEYGAVEDGAT
MTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNC
NLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESK
EASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLK
CQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA
Download sequence
Identical sequences W5PPF9
ENSOARP00000012335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]