SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012344 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012344
Domain Number 1 Region: 34-90
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-18
Family Fibronectin type II module 0.0034
Further Details:      
 
Domain Number 2 Region: 3-46
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000004
Family Fibronectin type II module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012344   Gene: ENSOARG00000011522   Transcript: ENSOART00000012523
Sequence length 91
Comment pep:known_by_projection chromosome:Oar_v3.1:14:53880606:53881262:-1 gene:ENSOARG00000011522 transcript:ENSOART00000012523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGKCFFPFRYRDGIFYDCVQFKVKHKWCSLNETYEGYWKYCSEEDFAKCVFPFWYRRLIY
WECTEDGDSFGKAWCSLTRNYNKDRIWKYCD
Download sequence
Identical sequences W5PPG8
ENSOARP00000012344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]