SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012426 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012426
Domain Number 1 Region: 154-272
Classification Level Classification E-value
Superfamily DNA clamp 1.4e-18
Family DNA polymerase processivity factor 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012426
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily DNA clamp 0.00485
Family DNA polymerase processivity factor 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012426   Gene: ENSOARG00000011593   Transcript: ENSOART00000012605
Sequence length 279
Comment pep:known_by_projection chromosome:Oar_v3.1:16:39157129:39163360:1 gene:ENSOARG00000011593 transcript:ENSOART00000012605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQRIPDENDYCLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQA
NAFIQAGIFQEFRVQEESVTFRINLTVLLDCLSIFGSSPVPGTFTALRMCYQGYGYPLML
FLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSDVLQITM
SPDKPYFRLSTFGNAGSSHLDYPKDSDLMESFHCNQTQVNRYKISLLKPSTKALVLSCKV
SIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPDS
Download sequence
Identical sequences W5PPP9
ENSOARP00000012426 XP_004017107.1.66739 XP_012018904.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]