SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012557 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012557
Domain Number 1 Region: 229-356
Classification Level Classification E-value
Superfamily TPR-like 8.92e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 2 Region: 163-226
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000062
Family FKBP immunophilin/proline isomerase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012557   Gene: ENSOARG00000011715   Transcript: ENSOART00000012742
Sequence length 416
Comment pep:novel chromosome:Oar_v3.1:5:4407130:4414974:1 gene:ENSOARG00000011715 transcript:ENSOART00000012742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCAEPSAADPEPTAPPPAGVPPLEDFEVLDGVEDAEGEEEEEEEDLSELPPLEDVGQP
PLEEAEQPGALAREFLAAMEPEPEPAPAPDEWLDILAGKRQLLVEILPTYPLLVSRSLKT
QDPLASTRASRRLDCDGQEGFSQPFAFTEPRCLAVHGLRCPSVPLMDVGETAMVTADSKY
CYGPQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRAD
FVLAANSYDLAIKAITSSAKVDMTFEEEEQLLQLKVKCLNNLAASQLKLDHYRAALRSCS
LVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQ
RSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Download sequence
Identical sequences W5PQ30
ENSOARP00000012557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]