SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012710 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012710
Domain Number 1 Region: 123-370
Classification Level Classification E-value
Superfamily vWA-like 1.93e-86
Family Integrin A (or I) domain 0.000000000476
Further Details:      
 
Domain Number 2 Region: 366-455
Classification Level Classification E-value
Superfamily Integrin domains 5.07e-33
Family Integrin domains 0.00000404
Further Details:      
 
Domain Number 3 Region: 622-706
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.96e-23
Family Integrin beta tail domain 0.00000429
Further Details:      
 
Domain Number 4 Region: 19-73
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000356
Family Plexin repeat 0.0000369
Further Details:      
 
Domain Number 5 Region: 580-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012710
Domain Number - Region: 506-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0198
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012710   Gene: ENSOARG00000011855   Transcript: ENSOART00000012896
Sequence length 778
Comment pep:novel chromosome:Oar_v3.1:11:45762020:45802167:1 gene:ENSOARG00000011855 transcript:ENSOART00000012896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCVKRNWMLKLLFSVAGPNICATRGVSSCQQCLAVSPMCAWCSDEALPPGSPRCNLKENL
LKDNCAPESIEFPISEARILEARPLSDKGTGDSSQITQVSPQRIALRLRPDDSKIFSVQV
RQVEDYPVDIYYLMDLSYSMKDDLRNIQNLGTKLASQMRKLTSNLRIGFGAFVDKPVSPY
MYISPPEAIRNPCYDMKATCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFD
AIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGNDNHYSAS
TTMDYPSLGLMTEKLSQKNINLIFAVTESVVNLYQNYSELIPGTTVGVLSTDSSNVLQLI
VDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVR
GCPQKKEKSFTIKPVGFKDSLTVQVTFDCDCACQAEAEPYSHRCNNGNGTFECGVCRCGP
GWLGSQCECSEEDYRPSQQDECSPREGQPICSQRGECLCGQCVCHSSDFGKITGKYCECD
DFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECG
SCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFNRGALNEENTCNRYCRDEIEPVKE
LKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAI
LLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Download sequence
Identical sequences W5PQI3
ENSOARP00000012710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]