SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013005 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013005
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily UBC-like 1.44e-45
Family UBC-related 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013005   Gene: ENSOARG00000012132   Transcript: ENSOART00000013194
Sequence length 131
Comment pep:novel chromosome:Oar_v3.1:6:22121073:22144303:1 gene:ENSOARG00000012132 transcript:ENSOART00000013194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKGTWYEEDFNTIFQFFYPFV
HCYVIQTQMTP
Download sequence
Identical sequences W5PRC6
ENSOARP00000013005 XP_012014710.1.54773 XP_012034997.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]