SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013016 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013016
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.89e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000013016
Domain Number - Region: 208-324
Classification Level Classification E-value
Superfamily ALDH-like 0.0255
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013016   Gene: ENSOARG00000012139   Transcript: ENSOART00000013205
Sequence length 356
Comment pep:known_by_projection chromosome:Oar_v3.1:2:53061224:53067598:1 gene:ENSOARG00000012139 transcript:ENSOART00000013205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLKGSFQASARAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPVPEAQDSVSSRSSRDVRSTDASLDEELDRVKMS
Download sequence
Identical sequences W5PRD7
XP_004004337.1.66739 XP_005683886.1.57651 XP_005970081.1.78601 XP_012003265.1.54773 ENSOARP00000013016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]