SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013059 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013059
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-41
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 2 Region: 637-781
Classification Level Classification E-value
Superfamily C-type lectin-like 5.06e-39
Family C-type lectin domain 0.000000237
Further Details:      
 
Domain Number 3 Region: 932-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 6.96e-39
Family C-type lectin domain 0.00043
Further Details:      
 
Domain Number 4 Region: 792-925
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-37
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 5 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.25e-35
Family Cysteine rich domain 0.000000908
Further Details:      
 
Domain Number 6 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 7.59e-35
Family C-type lectin domain 0.00024
Further Details:      
 
Domain Number 7 Region: 500-638
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-32
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 223-346
Classification Level Classification E-value
Superfamily C-type lectin-like 2.49e-31
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 9 Region: 1089-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 7.04e-30
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 2.63e-19
Family Fibronectin type II module 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013059   Gene: ENSOARG00000012176   Transcript: ENSOART00000013248
Sequence length 1455
Comment pep:known chromosome:Oar_v3.1:13:31334882:31447397:1 gene:ENSOARG00000012176 transcript:ENSOART00000013248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSPLLPLLSLLPVAVQLLDTRQFLIYNEDHKRCVEALSPSAVQTAVCNPNNEAQKFRW
VSESQIMSVALKLCLGVPSKTDWVPVTLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKVYGTTDDLCSRGYEAMYTLLGNANGATCAFPFKFENKWYG
ECTAAGRSDGWLWCGTTTDYDMDRLFGYCPLKFEGSESLWTKDPLTNIYYQINSKAALTW
HQARKSCQQQDAELLSITEIHEQTYLTGLTNSLTSGLWIGLNSLNFNSGWQWSGGSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAKWENLQCVQKLGYICKKGNTTLNPFVIPSESDVPT
NCPSQWWPYAGHCYRIYREEKKIQRDALRACRKEGGDLASIHSIEEFDFIISQLGYEPSD
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCAVMKGKDGYWADRACER
PLGYICKMKSQAQTPGVVEVEAGCQKGWKRHGFYCYLIGHTLSTFTEANQTCVSEKAYLT
TVEDRYEQAFLTSLVGLRPERYFWIGLSDVQQKGTFQWTVEEGVQFTHWNSDMPGRKAGC
VAMKTGVAGGLWDVLRCEEKAKFVCKHWAEGVTRPPAPTTTPEPKCPEDWGASSKTSLCF
KLFAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQAIWRLVTASGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPAMSWNDINCEHLNNWICQIR
KGQTPKPEPTPAPHDNLPVTDDGWVIYKDYQYYFSKEKATMDKAREFCKRNFGDLTSIRS
ESEKKFLWKYVNRNDVQPAYFIGLLISLDKKFIWMDGSKVDYVAWATGEPNFANDDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSINATAVPTTVSVPGGCKEGWNFYNHKCFKIFG
FVEEERKNWQEARKDCIGFGGNLASIHNEKEQAFLTYHMKNSTFNAWTGLNDINSEHTFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNTRDAGKWMDDTCDSKRGYICQT
QPDPSLPSSPTTTLTDGFIKYGESSYSLMKLKLQWHEADNYCKMHNSHIASILDPYSNAF
AWMHMQTLNEPVWIALNSNLTNNDYIWTDKWRVRYTNWAADEPRLKSACAYMDLDGYWKT
AQCNESFYFLCKRSDEIPATEPPQLPGRCPETEHSAWIPFHGHCYYIESSFTRNWGQASL
ECLRMGSSLVTIESAAELSFLSYRVEPLQSKTNFWIGLYRNVEGMWLWINNNPVSFVNWK
TGDPSGERTDCVTLYASSGLWSNIHCSSYKGYICKRPKIVDAEPTHTLITTKADPRKMEP
SKPSSSATGVVVIVVLLIILGAGFAVYFFYKKRRVHLPREDAFENTLYFNSGSSPGTNDT
KDLMGNIEQNEHAAI
Download sequence
Identical sequences W5PRI0
ENSOARP00000013059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]