SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013153 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013153
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-40
Family FKBP immunophilin/proline isomerase 0.000001
Further Details:      
 
Domain Number 2 Region: 256-416
Classification Level Classification E-value
Superfamily TPR-like 8.6e-33
Family Tetratricopeptide repeat (TPR) 0.0000000603
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-26
Family FKBP immunophilin/proline isomerase 0.000000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013153   Gene: ENSOARG00000012272   Transcript: ENSOART00000013346
Sequence length 457
Comment pep:known_by_projection chromosome:Oar_v3.1:20:9692040:9766541:-1 gene:ENSOARG00000012272 transcript:ENSOART00000013346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEAAKNNGESPAAAVAEQGEDITSKKDRGVLKIVKRVGNSEETPMIGDKVYVHYRGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRIKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVGFIVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEASKAMSKKTLEGVTNEKEIGSPPMDEQKAEGHV
Download sequence
Identical sequences W5PRS4
ENSOARP00000013153 XP_014958158.1.66739 XP_014958159.1.66739 XP_014958160.1.66739 XP_014958161.1.66739 XP_017894446.1.57651 XP_017894447.1.57651 XP_017894448.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]