SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013274 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013274
Domain Number 1 Region: 481-997
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.81e-149
Family alpha-mannosidase, C-terminal domain 0.000000000000158
Further Details:      
 
Domain Number 2 Region: 52-390
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.85e-117
Family alpha-mannosidase 0.0000000000198
Further Details:      
 
Domain Number 3 Region: 393-498
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 3.92e-30
Family alpha-mannosidase, domain 2 0.00000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013274   Gene: ENSOARG00000012384   Transcript: ENSOART00000013469
Sequence length 1003
Comment pep:novel chromosome:Oar_v3.1:5:10917612:10932688:1 gene:ENSOARG00000012384 transcript:ENSOART00000013469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGDARPSGVRAGGCRGAVESRTSFRAPRPPLPPLSFLFVLFLAAPCAWAAGYKTCPKVK
PDMLNVHLVPHTHDDVGWLKTVDQYFYGIYNNIQQAGVQYILDSVISSLLADPTRRFIYV
EIAFFSRWWHQQTDATQKIVRDLVRQGRLEFANGGWVMNDEATTHYGAIIDQMTLGLRFL
EETFGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKKVRETALQMEQVW
RRPGRSRGHDHPLSLMWSAGVLPNMYSPPEGLCWDMLCADKPFVEDVRSPEYNAKELVHH
FLKLATDQGKLYRTKHTVMTMGSDFQYENANMWFKNLDKLIQLVNAQQQANGSRVNVLYS
TPACYLWELNKAKLNWSVKKDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQ
LEALAGPAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVADDYARQLSEGWRPCQV
LMSNALAHLSGLKEDFAFCRKLNISICPLTQTAERFQVIVYNPLGRKVDWMVRLPVSKHV
YLVRDPGGKTVPSDVVTIPSSDSQELLFSALVPALGFSIYSVSQMPDQSPQNSWSRDLVI
QNEYLRARFDPDTGLLMELENLEQNLLLPVRQAFYWYNASTGNNLSSQASGAYIFRPNRN
KPLFVSRWAQTHLVKASLVQEVHQNFSAWCSQVIRLYPRQRHLELEWTVGPIPVGDGWGK
EVISRFDTGLATGGLFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNSRIYITDG
NMQLTVLTDRSQGGSSLTDGSLELMVHRRLLKDDERGVGEPLNSEGSGLWVRGRHLVLLD
KKGTAAASHRLQAEMEVLAPQVVLAPGGGARYRLERAPRTQFSGLRRELPPSVRLLTLAR
WGRETLLLRLEHQFAVGEDSGRNLSSPVTLDLTNLFSAFTITHLRETTLAANQFLAYASR
LQWTTDTGPTPHPSPSRLVSATITLHPMEIRTFLASVQWEEDG
Download sequence
Identical sequences W5PS45
ENSOARP00000013274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]