SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013281 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013281
Domain Number 1 Region: 348-478
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-41
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 205-340
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 932-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-33
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 4 Region: 811-920
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-28
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 5 Region: 11-142
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.52e-25
Family Cysteine rich domain 0.0032
Further Details:      
 
Domain Number 6 Region: 1199-1329
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-24
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 7 Region: 658-776
Classification Level Classification E-value
Superfamily C-type lectin-like 1.35e-24
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 8 Region: 142-200
Classification Level Classification E-value
Superfamily Kringle-like 2.03e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 9 Region: 489-579
Classification Level Classification E-value
Superfamily C-type lectin-like 7.56e-20
Family C-type lectin domain 0.0047
Further Details:      
 
Domain Number 10 Region: 1108-1201
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000367
Family C-type lectin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013281   Gene: ENSOARG00000012392   Transcript: ENSOART00000013476
Sequence length 1333
Comment pep:known_by_projection chromosome:Oar_v3.1:11:46503733:46528230:1 gene:ENSOARG00000012392 transcript:ENSOART00000013476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCPAFLPEPSVFVIFSHGLQGCLEAQGGQVRVSPACNASLPAQRWKWVSRNRLFNLGT
MQCLGTGWPGTNTTASLGMYECDREALSLRWNCRTLGDQLSLLLGGRSGNTSKAGTPERG
DQTRSGQWRIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGH
LWCATTQDYGKDERWGFCPIKGNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQG
ADLLSITEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNP
SEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAAEPPPPDVWANVKVECEPSWQPF
QGHCYRLQAEKRSWQESKKMCLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKL
QMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQ
LSQGAAEEDHGCRQGWTWHXLGEEEVTYSEARRLCTDHGSQLVTITNRFEQAFISSLIYN
WDGEYFWTALQDLNFTGSFRWLSGDEVMYTHWNRDQPGLGLGAIIGTISGRCLCQFSSPR
APSLMSRAVLTSLDTLSSKAAAPSPHKSWEGRCPVGRWARGTAWTLPLQVFSSERLQDKK
TWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGELEPEIHEQHWFWIGLNRRDPGA
GQSWRWSDGLGFSYHNFDRSRHDDDDIRGCTVLDLASLQWVAMQCETQLDWICKIPRGTD
VREPDVSPQGEASCPSHSPWRPDRAGLDQDRSRAQAQRICTWFQAELVSVHSQAELDFLG
HNLQKFSRGQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMMAS
REDWGDQRCTTALPYICKRRNSTRELQPPDLPPTGGCPSGWSQFLNKCFRIQGQDPQDRV
KWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLQY
ANWAPGEPSGPSPAPSGNIPPGCAVVLHSPSTHFTGRWDDQSCTEETHGFICQKATDPSL
SPSPAASPPAPGTELSYLNGTFRLLQKPLRWHDAAFLTQAARGLRTPLWIGLASEEPDGP
LCPGLPAVYVSWQDGEPQLPGGCAYVDTDGTWRTTICDTKLQGAVCGVHGGPPPPRRISY
HGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGGAVLSILDEMENVFVWEH
LQSSEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSG
LWRPGACTNITMG
Download sequence
Identical sequences W5PS52
ENSOARP00000013281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]