SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013383 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013383
Domain Number 1 Region: 173-322
Classification Level Classification E-value
Superfamily TPR-like 6.27e-19
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 2 Region: 7-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 1.2e-18
Family FKBP immunophilin/proline isomerase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013383   Gene: ENSOARG00000012489   Transcript: ENSOART00000013580
Sequence length 330
Comment pep:known_by_projection chromosome:Oar_v3.1:21:44651161:44657106:1 gene:ENSOARG00000012489 transcript:ENSOART00000013580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIIARLREDGIQKRVIQEGRGALPDFQDGTKATFHYRTLRSDEEGAVLDDSRVRGKPM
ELIIGKKFKLPVWETIVRTMREGEIAQFCCDVKHVVLYPLVAKSLRNIAAGKDPLEGQRH
CCGIAQMHEHNSLGHADLDALQQNPQPLIFDIEMLKVENPGTYQQDPWAMTDEEKAKAVP
VIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDQQITPLLLNYCQC
KLVAEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLQLDPALAP
VVSRELRALEARIRQKDEEDKARFRGIFSH
Download sequence
Identical sequences L8I598 Q3SZ99 W5PSF4
ENSBTAP00000013841 ENSOARP00000013383 NP_898905.2.59421 NP_898905.2.76553 XP_004019768.1.66739 XP_005700004.1.57651 XP_005903626.1.15283 XP_010835990.1.44457 XP_011972856.1.54773 XP_020743454.1.74333 ENSBTAP00000013841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]