SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013448 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013448
Domain Number 1 Region: 11-368
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.03e-90
Family Extradiol dioxygenases 0.0000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013448   Gene: ENSOARG00000012549   Transcript: ENSOART00000013646
Sequence length 393
Comment pep:known_by_projection chromosome:Oar_v3.1:17:53045233:53057033:1 gene:ENSOARG00000012549 transcript:ENSOART00000013646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYSDKGEKPERGRFLHFHSVTFWVGNAKQAASYYCSKLGFEPLAYKGLETGSREVVSH
VVKQGQIVFIFSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIVRE
PWVEQDKLGKVKFAVLQTYGDTTHTLVEKMNYTGRFLPGFEAPAFMDPQLSKLPNCGLEI
IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTKDIITAIRHLRERGVEFLAVPSTYYKQLR
EKLKSAKIRVKENIDILEELKILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQDLRGNLTDMEPNGVVSSM
Download sequence
Identical sequences W5PSL9
XP_004017393.1.66739 XP_011965648.1.54773 ENSOARP00000013448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]