SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013455 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013455
Domain Number 1 Region: 294-554
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-75
Family Eukaryotic proteases 0.0000752
Further Details:      
 
Domain Number 2 Region: 172-278
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 3 Region: 72-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000996
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 111-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013455   Gene: ENSOARG00000012554   Transcript: ENSOART00000013653
Sequence length 558
Comment pep:known_by_projection chromosome:Oar_v3.1:22:32978232:33012630:1 gene:ENSOARG00000012554 transcript:ENSOART00000013653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMVLAGKTAFGFSLLSFLTDLDPDWTPDQYEYSQEYYNQEENASSTPA
YSDNPDWYYEEDDPCLSNPCTHGGDCLISGATFTCRCRDPFSGNRCQNVQNKCKNNPCGR
GDCLITQSPPYHRCACRHPYMGSDCSRVVPVCRPNPCQNGGTCSRQRRRSKFTCACPDQF
KGKLCEIGPDDCYVDDGYSYRGKVSRTVNQHSCLYWNSHLLLQEKYNVFMEDAEAHGIGE
HNFCRNPDGDKKPWCFFKVNNAKVKWEYCDVPACSAPDVANPEGRPAEPLTKFPEFGSCG
KTEIAEKKLKRIFGGFKSTAGKHPWQASLQTSLRLTVSMPQGHYCGGALIHPCWVLTAAH
CTEIKTKYLKVVLGDQDLTKTEFHEQSFGVQKIFKYSHYVEIDDIPYNDIALLKLKPVDG
HCALESKYVKTVCLPDGPFPSGTECHISGWGVTETGEGSRQLLDAKVKLISNTICNSRRL
YDHSIDDNMICAGNLQKPGQDSCQGDSGGPLTCEKDGTSYVYGIVSWGLECGKKPGVYTQ
VTKFLTWIKTTMEKEASF
Download sequence
Identical sequences W5PSM6
ENSOARP00000013455 XP_004020252.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]