SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013608 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013608
Domain Number 1 Region: 50-296
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.02e-91
Family Carbonic anhydrase 0.0000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013608   Gene: ENSOARG00000012701   Transcript: ENSOART00000013810
Sequence length 317
Comment pep:known_by_projection chromosome:Oar_v3.1:X:13207257:13228553:1 gene:ENSOARG00000012701 transcript:ENSOART00000013810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMSYLRVILQASPCKTLWRRFQIPRSTPARLCSLYTCTYKSRNRVLHPLWEKVDLASA
GEHQSPINIRWRDSVYDPGLQPLTISYDPTTCLHVWNNGYSFLVEFEDSADKSVIEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFEHFEDAALEENGLAVI
GVFLKLGKHHKELQKLVNILPSIKHKDTLAEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNIQAKPKPSTSQVTP
Download sequence
Identical sequences W5PT28
XP_004021982.1.66739 XP_011961663.1.66739 ENSOARP00000013608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]