SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013769 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013769
Domain Number 1 Region: 31-142
Classification Level Classification E-value
Superfamily FKBP-like 1.96e-28
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 168-315
Classification Level Classification E-value
Superfamily TPR-like 1.79e-20
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013769   Gene: ENSOARG00000012861   Transcript: ENSOART00000013974
Sequence length 327
Comment pep:known_by_projection chromosome:Oar_v3.1:24:33705425:33727177:-1 gene:ENSOARG00000012861 transcript:ENSOART00000013974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSAQNPGVLQRDDSPRQSPYQRLSQRMLDISGDRGVLKDVIREGAGELVTPDASVLVK
YSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGT
LGCPPLIPPNTTVLFEIELLDFLDSAESDKFCALSAEQQSQFPLQKVLKVAATEREFGNY
LFRQNRFYDAKVRYKRALLLLHRRTAAPEEQHLVETAKLLVFLNLSFTYLRLERPAVALR
YGEQALIIDQKNAKALFRCGQACLLMTEYQKARDFLVRAQREQPFNHDINNELKKLASYY
RDYMDKEREMCHRMFAPGDNGSTVGEN
Download sequence
Identical sequences W5PTI8
XP_011959859.1.66739 ENSOARP00000013769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]