SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013909 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013909
Domain Number 1 Region: 842-1000,1200-1322,1485-1570
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.42e-44
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 1368-1662
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-40
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 421-514,566-670
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.07e-20
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 1645-1802
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000534
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013909   Gene: ENSOARG00000012971   Transcript: ENSOART00000014115
Sequence length 1806
Comment pep:known_by_projection chromosome:Oar_v3.1:24:489843:511494:1 gene:ENSOARG00000012971 transcript:ENSOART00000014115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRAGQQQGRGGPTPPMWQQPFLNVFRHFKVDEWKRSTRGGDVAAVTDKTLKCTVYRVRGA
VSASNYIQLPKTSTQSLGLTGRYLYVLFRPLPAKHFVIHLDVSTEDSQVIRVSFSNLFKE
FKSTATWLQFPFICEAGTPREDLPGVAFPGARWTCLQLDLHDILLVYLQRCYSHLKGVRL
CASMLVRSLYTSDLCFDPAITVAEARRSKLPVTPIPREMAFPVPKGESWHDRYVHIRQPR
FPSGSSHVPSELVQKSGFPPEAAAVLAGRVPRLLPSPGACSKPARDSRARVVQKHDPTAS
RWATSMPRPLPEVSVSCERSEVSRVVGPSDCIQEPPAWLESTDWVAFLGGQNWLWAGQPC
CDRGLATWVSLCVCLFQSFLPDPILRLKGVVGFGGHSTKWADGAAVVYPCHAVVVALRVE
TREQRLFLGHTDKVSALALDGSSSLLASAQGPPHTMLRLWDFQTGSCLALFRSPVHTISS
LSFSNNGELLCGVGKDRHGRTTVLVWGMAQLGRGGEAVILAKAHSDADVQAFEIAAFDEA
RRMPDFRRSWGSWALPSALTAHPPPQLYDFPSPEEAPRAVAFHPIQPTFFCGFSSGAVRS
FSLEAAEVLVEHSACSLPLQTPRGPLAPKRTFSSAPGIAINSLSVSRSACAVGSEDGYLR
LWPLDFSSVLLEAGRACTPPHPQAAQEGHVARLDSLATLQQVGCGQRAPAGGAVWRLQDT
LRPGVAGQAPTPGSAWASQYLPDHVPVSHSLPHRPTGPGVVSGLPSSPQVGDQSAPALRQ
DGAVSGWSLGEPRRSGSARCRGVHPAQLTARPLVLAANVVCQEACPSSSILAVSEDSCLL
AFVGPSKYTVSIVDTASLDELLRVNVSALDLAGSCLDSAVALCFGPSPPSHLLVSTSSNT
IAVLDARSGHVVRELSCGNPAACASLALSADGRFLLTAAERAVRLWDYAMQAGLSCQVYI
GHSEPVRAVAFTPDQQQLLSVGDAIFLWDILVPREGWSPGSLAPLSAGPGAGELEGVAAG
ARGAPRQVSESPPVLPPQPGLCAGPPEDFDGEGEGPGRGRLPDRSHGPEDLHQASGPSVL
VQKEAGRAGDGACGVTGGPWDLGRRPHPCGWPSVCSTVGARARRPRGPPGPGHCPAAPPQ
APPLPPAGDEWLRLKAVVGYNGNGRTNLVWSPDTGFFAYTCGCLVVVEDLHSGAQQHWLG
HPEEISTLALSHDAQVLASASGRSGAASRCQIRLWDVPRGSCRQLLSHHDTAVQALAFSL
QQALCVSPGDCGDGTLALWSTATCELLSSTRLPEPVHGMAFSPWHTGELACGGQGMHTGE
LACVGQGILTLQLLWGQAGDVSLQAHREPVPEELGGCELSSLCYGAAPLLYCGSNEGQVC
VWDTRAGCCFLAWEADEGEIGVLLCSGTWLVSGSNTRRLRLWAVGAVPELRRRGSGARSS
SVFLERELTLDGAVVSAVFHDSMDMGVVGTTAGTLWYISWAEGTSTRLISGHRSKVNEVA
FSPDESHCATCSDDGSVRVWCVASTELLIQFQVLSQSCLCLAWSPQSCGCPEEQHVAAGY
SDGTLRVFSIPRSAVELKMYPHTAALTALAFSADGQTIVSGDKDGLVAVSHLRTGMTFRV
LSDHRGAPICTLQSTRKECGDFGAEGTDLWLAASGDQRVSVWASDWLRDHCELVDWLSFP
APSLAEVPSCLPPSLAAFCPWDPALLVCAGLGVSPEVAFYSLRQKQVVEKIPLPFFAVSM
SLSPGAHLVAIGFSERMVRLLDCASGTVQDFAGHDDSVQLCRFAPSAQLLFTAAHSEILV
WEVTGH
Download sequence
Identical sequences W5PTX8
ENSOARP00000013909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]