SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013912 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013912
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.58e-77
Family Phosphate binding protein-like 0.00000363
Further Details:      
 
Domain Number 2 Region: 239-297,331-353
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.05e-18
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013912   Gene: ENSOARG00000012985   Transcript: ENSOART00000014118
Sequence length 361
Comment pep:known_by_projection chromosome:Oar_v3.1:15:29153798:29160700:1 gene:ENSOARG00000012985 transcript:ENSOART00000014118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAATAEEDTPKMRVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALERNEVDLVVHSLKDLPTVLPPGFTIGAVCKRESPY
DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRNIRGNLNTRLRKLDEL
QEFSAIILAAAGLQRMGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHD
PETLLRCIAERSFLRHLEGGCSVPVAVHTAIKDGQLYLTGGVWSLNGAETMQDTMQTTIH
VPVQHEDGPEDDPQLVGITARNIPRQPQLAAENLGISLATLLLNKGAKNILDVARQLNEA
H
Download sequence
Identical sequences W5PTY1
ENSOARP00000013912 XP_004016140.1.66739 XP_005689593.1.57651 XP_011973193.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]