SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013983 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013983
Domain Number 1 Region: 91-206
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.1e-35
Family Frataxin-like 0.000000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013983   Gene: ENSOARG00000013055   Transcript: ENSOART00000014190
Sequence length 217
Comment pep:known_by_projection chromosome:Oar_v3.1:2:67065868:67087728:-1 gene:ENSOARG00000013055 transcript:ENSOART00000014190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRSVASFLTRSALPGFAPNSAGPPRPAKDLSLSGLQGLRIGTAAAPARSQSSLSL
RCLNQTLDVKKQSVCWINLRTAGTLGDAGTLDDTTYERLAEETLDSLAEFFEDLADKPYT
SEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGRNWVYSHDG
MSLHELLATELTQALKTKMDLSALAYSGKDTSCPAQC
Download sequence
Identical sequences W5PU52
XP_004004381.1.66739 ENSOARP00000013983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]