SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014020 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014020
Domain Number 1 Region: 25-483
Classification Level Classification E-value
Superfamily ALDH-like 2.82e-68
Family ALDH-like 0.00000731
Further Details:      
 
Domain Number 2 Region: 520-762
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-41
Family ALDH-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014020   Gene: ENSOARG00000013087   Transcript: ENSOART00000014227
Sequence length 807
Comment pep:known_by_projection chromosome:Oar_v3.1:14:54943795:54956985:1 gene:ENSOARG00000013087 transcript:ENSOART00000014227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRTASRAGEIFTTLEYGPAPESHACALAWLDTQDRHLGHYVNGQWLKPEHRSSVPCQ
DPITGENLASCLQAQSEDVAAAVEAARASLENWSTQPGAFRAQHLTRLAKAIQKHQRLLW
TLESLVTGRAVREVRDRDVPLAQQLLQYHAVQVLAAHQEEALAGWEPMGVIGLILSPTFP
FLDMMWRICPALAVAPGCTVVVLAPASPTPLLLAQLAGELGPFPGILNVISGPASLGPVL
AGQPGVLQGALWGVEEGRALRRHEQGRALGDESLLLLTEVADVDSAVEGIVDAAWSDRSR
FNFQFFMAPNPFIFTPLPLKFLSLHVPTSPGPDGAVDMGARGDAARDLAQRYVREAQSQG
AQVFQAGSVPSDSPFFPPTLVSDLPPASPCTQAEVPWPLVVASPFRTAKEALAVANGTPR
GGSASVWSERLGQALELAYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGQDGLYEY
LRPSGTPAWIPYLSKTLDYDSFGLALPSALPAGPETGPAPPYGLFVGGRFQAPGARSSRP
IRDSQGSLLGYVAEGGAKDIRGAVEAAHQAAPGWMSQSPAARAALLWALAAALQRREPNL
VSRLERHGVELKVAKVEVELSVKRLRAWGARVQAQGCALQVAELRGPVLRLREPLGVLAI
VCPDEWPLLAFVSLLAPALAHGNTVVLVPSGASPIPALEVCQEMAALLPAGLVNVVTGDR
DHLTRCLALHQDIQALWYFGSAQGSQFVEWASAGNLKPVWVNRGCPRAWDQEAEGAGPEL
GLGGPRATARIAQHSHSISDREDMDPN
Download sequence
Identical sequences W5PU89
ENSOARP00000014020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]