SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014052 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014052
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.49e-96
Family Carbonic anhydrase 0.000000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014052   Gene: ENSOARG00000013116   Transcript: ENSOART00000014259
Sequence length 260
Comment pep:known_by_projection chromosome:Oar_v3.1:9:89665649:89675609:-1 gene:ENSOARG00000013116 transcript:ENSOART00000014259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEWGYADHNGPDHWHELYPIAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKYNSYATALKHPDGIAVIGVFLKIGREKGEFQLFLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
Download sequence
Identical sequences W5PUC1
XP_011998685.1.54773 XP_014953428.1.66739 XP_017913667.1.57651 ENSOARP00000014052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]