SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014059 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014059
Domain Number 1 Region: 250-417,447-508
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 512-681
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.38e-29
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.48e-19
Family Flavin-binding PAS domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014059   Gene: ENSOARG00000013121   Transcript: ENSOART00000014266
Sequence length 980
Comment pep:known_by_projection chromosome:Oar_v3.1:11:47266979:47290236:1 gene:ENSOARG00000013121 transcript:ENSOART00000014266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPRSAMSRLAQALLGAEECKVDILYYRKDASCFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKRERVSMSRAALTQAFVSEGSHGRPGAQGPGAGRVKYRTISQI
PQFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQA
PRIHRGTLLHYSPFKAVWDWLILLLVIYTAVFTPYSAESQRGDCGYTCSPLTVVDLIVDI
MFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLIFRTGSDETT
TLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNVERPY
LEPKIGWLDSLGAQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFGNVSPNTNSE
KVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRL
EEYFQHAWSYTNQADICLHLHRALLQHCPAFHGASKGCLRALAVKFKTTHAPPGDTLVHL
GDVLSTLYFICLDQAVPRDTIPEAGLAGKNDIFGEPVSLHARPGKSSADVRALTYCDLHK
IQRADLLEVLDMYPAFADSFWSKLEVTFNLRDAGGGHQPSPQQAPRSQDHQGFFLSDNQS
GEQNRPLPESAPPSPEGPAQPPGPWRGLLRLSIGAPVSLLPLCPQSLSAAPSLSISDASG
LWPELLQQVPPRPSQSPPNPQGDSDCWPRELGSRLEQLQAQMNRLESRMSSDLSRILKLL
QQPLPQDHTGYILGASASNDLALFPATSATQSPGTQLPRGDPPPAQMPSYGDTDEWRPEL
RNSSSRMPLSAMEMDRTLTLSSEQKQPEGLLSPLASPLCPLEIQGLVCGPRFPSLPEHLS
SVPKQLEFQRHGSDPGFSRS
Download sequence
Identical sequences W5PUC8
ENSOARP00000014059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]