SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014093 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014093
Domain Number 1 Region: 583-834
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.94e-55
Family Eukaryotic proteases 0.0000377
Further Details:      
 
Domain Number 2 Region: 489-584
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-32
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 3 Region: 393-475
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 4 Region: 213-300
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-25
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 5 Region: 300-384
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-24
Family Kringle modules 0.00039
Further Details:      
 
Domain Number 6 Region: 135-222
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 8.44e-17
Family Hairpin loop containing domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014093   Gene: ENSOARG00000013151   Transcript: ENSOART00000014300
Sequence length 836
Comment pep:known_by_projection chromosome:Oar_v3.1:19:50453611:50459404:1 gene:ENSOARG00000013151 transcript:ENSOART00000014300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASTLTTGRAGDARGATGKPAHLGARPPLTHPPSPPSPGSQHLPSSRLRRPAAPPLPTSA
RPSATAPVRGQTEPRSRLAPTAQPLSPPSPTCAGAGGAPGPAVPLTLCPERPWPPISLLL
PVFGDPAQRSATGQRSPLNDFQVLRGTELQHLLHSGGPRPWQEDVANAEECAGRCGPLLD
CRAFHYNLSSHGCQLLPWTQHSPHTRLQRSGRCDLFQKKNYVRTCIVDTGVEYRGTVAIT
VGGLPCQHWSQRFPNDHKFTPTLRNGLEENFCRNGGPWCYTTDPAVRFQSCGIKSCQEAA
CLWCNGEDYRGSVDSTESGRECQRRGGPRPPGSCLRPATAPRFLDKNLDDNYCRNPDGSE
RPWCYTTDPQMEREFCDLPRCGFEAQPSQEATTLNCFRGKGEGYRGTANTTAAGVPCQRW
DAQLPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRMAFCYQIRRCGGLGRE
PADGRPCPPTADCYHGAGELYRGSVSKTRKGIRCQNWSAETPHKPQFKHTSAPHAPLEEN
FCRNPDGDSHGPWCYTTDPGTPFDYCALRRCDDDQQPSILETAHQVLFDKCGKRVTRVDP
LRSKLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHTSLVGYEVW
LGTLFQDPQPGEPDLQRIPMAKMVCGPSGSQLVLLKLESSRPVILNQRVALICLPPERYV
VPPGTRCEIAGWGETKGTGDDTVLNIALLNVISNQECNVKHRGRVRESEMCTAGLLAPVG
ACEGDYGGPLACFTHDCWVLQGIIIPNRVCARPRWPAIFMRVSVFVDWIHKVMRLG
Download sequence
Identical sequences W5PUG1
ENSOARP00000014093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]