SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014243 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014243
Domain Number 1 Region: 248-351
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.15e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 
Domain Number 3 Region: 93-160
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000733
Family Heme-binding PAS domain 0.086
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000014243
Domain Number - Region: 489-537
Classification Level Classification E-value
Superfamily Tropomyosin 0.0294
Family Tropomyosin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014243   Gene: ENSOARG00000013285   Transcript: ENSOART00000014450
Sequence length 804
Comment pep:known_by_projection chromosome:Oar_v3.1:3:100410014:100502795:-1 gene:ENSOARG00000013285 transcript:ENSOART00000014450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQEPVPCVDRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQPDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSILYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKMLSSHMLMTDAPSPEYLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDGALSRPCRVPLGKDVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYAEVRVER
RQELALEDPLLETVHPSALKDKGSSLEPQQHFNALDMGTSGLNTSHSPSASSRSSHKSSR
TAMSEPTSTPSKLRAEASTPALPRSAQELPVPGLSQAAAMPAPLPAPASCDLTQQLLPQT
ILQSPPAPVSQFEGSWNALETIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQ
MFLQPPDGSLSFSSAQRPETQQQLQQRSGPGPQLVASPQLPGQIASAQVTNQHLLRESSV
ILTQGPKPLRSSQMIQGSNLTPQFSSTTTALPLALSLTTPASASQEAPQGQPSPDFSHDR
QLRLLLSQPIQPMMPGSCDARQPSEVRRTGRQVKYPQSQAVFQNPDVHTTSSNAATPVLL
MGLQPSFATSQPSPLKPAQAQPQPPHFLQVQVPTSLHSEQQDSLLLSTYSQQPGTLGYPT
PGPARPARRVSSLSESSGLQQPPR
Download sequence
Identical sequences W5PUW1
ENSOARP00000014243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]