SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014355 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014355
Domain Number 1 Region: 440-784
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.01e-107
Family PDEase 0.00000137
Further Details:      
 
Domain Number 2 Region: 185-281
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000314
Family Heme-binding PAS domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000014355
Domain Number - Region: 55-122
Classification Level Classification E-value
Superfamily CheY-like 0.00141
Family CheY-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014355   Gene: ENSOARG00000013382   Transcript: ENSOART00000014565
Sequence length 788
Comment pep:known_by_projection chromosome:Oar_v3.1:18:21759426:21904086:1 gene:ENSOARG00000013382 transcript:ENSOART00000014565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSGHRPEIRDHWLGGDHVRPWVAVADVQFGPMRFHPDQLQVLLVFTKEDNQCNGFCRA
CEKAGFMCTVTKEAQTALACFLDKHHDIIIIDHRNSRHLDAEALCRSIRSSKLSENTVII
GVVRRVDREESCVMSLIAAGFTRRYIENPSPMACYNELLQLEFGEVRSQLKLRACNSMFA
ALEKSQEAIEITSEDHIIQYANPAFETTMGYQSGELIGKEIAEVPINEKKADLLDTINSC
KEWQGIYSVRKKNGDNVQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKIAECVQTDS
YADNQSGKHKDRRKSSLDVKTVASRTNEVSSQRRHSSMARIHSMTIEAPITKVINIINAA
QESSPMPVTEALDRVLEILRTTELYSPQFGAKDDDPHANDLVGGLVSDGLRRLSGNEYVL
STKNLQQAAGSSIVPISLHDVPSQITRAMEKEEYWDFNIFELEAATHKRPLIYLGLKVFA
RFGVCEFLKCPEATLRSWLQVIEANYHASNPYHNSTHSADVLHATAYFLCKERIKQTLDP
LDEVGALLAATIHDVDHPGRTNSFLCNAGSELAILYNDMAVLEHHHAALAFQLTTGDDKC
NIFKNMERNRSDYQTLRQGIIDMVLATEMTKHFEHVNKFVNIINKPLVALEEDEETDKDQ
EAINTMLRTPENRTLIKRMLIKCADVSNPCRPLEQCIEWAARISEEYFSQTDEEKQRDLP
VVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFVDLPELMQHLDNNFKYWKGLDDMKL
RSLRPPPE
Download sequence
Identical sequences W5PV73
ENSOARP00000014355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]