SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014402 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014402
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 6.87e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 131-182
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 0.00000000000000392
Family VPS28 C-terminal domain-like 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000014402
Domain Number - Region: 173-205
Classification Level Classification E-value
Superfamily PEBP-like 0.0755
Family Phosphatidylethanolamine binding protein 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014402   Gene: ENSOARG00000013435   Transcript: ENSOART00000014614
Sequence length 231
Comment pep:known_by_projection chromosome:Oar_v3.1:9:13460501:13464151:1 gene:ENSOARG00000013435 transcript:ENSOART00000014614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPLHLRR
ARGGVGRPQAPLYRLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQGGGAVPHSPPCPPLHTHRSTVALPPRQSPSSKPHSLTHTHPSPTALPLH
Download sequence
Identical sequences W5PVB9
ENSOARP00000014402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]