SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014441 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014441
Domain Number 1 Region: 83-116
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000714
Family Fibronectin type II module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014441   Gene: ENSOARG00000013472   Transcript: ENSOART00000014654
Sequence length 134
Comment pep:novel chromosome:Oar_v3.1:6:114818816:114819689:1 gene:ENSOARG00000013472 transcript:ENSOART00000014654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIEAGPHVRGPPHTPHHSPLGPSQSQGEPPGHNATVTPVTPVTSVTPSTAAVGASQTEG
PPGGGLTPLPWGAPSNGPGGTVLTEAGQPCRFPFRYGGRMLHSCTAEGSAHRKWWVPVPA
PPTPTRGASTPQPA
Download sequence
Identical sequences W5PVF8
ENSOARP00000014441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]